PFAS Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PFAS antibody: synthetic peptide directed towards the N terminal of human PFAS. Synthetic peptide located within the following region: ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	145 kDa
Gene Name	phosphoribosylformylglycinamidine synthase
Database Link	NP_036525 Entrez Gene 5198 Human UniProt ID O15067
Background	Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. The enzyme encoded by this gene catalyzes the fourth step of IMP biosynthesis. [provided by RefSeq, Jul 2008]
Synonyms	FGAMS; FGAR-AT; FGARAT; PURL
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 92%; Pig: 86%; Guinea pig: 86%; Bovine: 83%; Rabbit: 79%
Reference Data
Protein Pathways	Metabolic pathways, Purine metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.