UBE2Q2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-UBE2Q2 antibody is: synthetic peptide directed towards the middle region of Human UBE2Q2. Synthetic peptide located within the following region: EDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	ubiquitin conjugating enzyme E2 Q2
Database Link	NP_775740 Entrez Gene 92912 Human UniProt ID Q8WVN8
Background	UBE2Q2 accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro UBE2Q2 catalyzes 'Lys-48'-linked polyubiquitination.
Synonyms	DKFZp762C143
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 92%
Reference Data
Protein Pathways	Ubiquitin mediated proteolysis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.