PER3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PER3 Antibody: synthetic peptide directed towards the N terminal of human PER3. Synthetic peptide located within the following region: GAPQADVSMYSLEELATIASEHTSKNTDTFVAVFSFLSGRLVHISEQAAL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	132 kDa
Gene Name	period circadian clock 3
Database Link	NP_058515 Entrez Gene 8863 Human UniProt ID P56645
Background	PER3 is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known.
Synonyms	FASPS3; GIG13
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 92%; Dog: 79%; Rat: 79%
Reference Data
Protein Families	Druggable Genome, Transcription Factors
Protein Pathways	Circadian rhythm - mammal

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.