C10orf88 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C10orf88 Antibody is: synthetic peptide directed towards the C-terminal region of Human C10orf88. Synthetic peptide located within the following region: ELLPFLQNLCSQVNHLHVGNKTECQENITKHGERILGVGMEEQSICSYLE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	chromosome 10 open reading frame 88
Database Link	NP_079218 Entrez Gene 80007 Human UniProt ID Q9H8K7
Background	The function of this protein remains unknown.
Synonyms	FLJ13490
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.