LIPT2 Rabbit Polyclonal Antibody
CAT#: TA331034
Rabbit polyclonal Anti-LIPT2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,200.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-LIPT2 antibody is: synthetic peptide directed towards the C-terminal region of Human LIPT2. Synthetic peptide located within the following region: TDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 25 kDa |
Gene Name | lipoyl(octanoyl) transferase 2 (putative) |
Database Link | |
Background | LIPT2 catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate. |
Synonyms | LIPT2 |
Note | Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 79% |
Reference Data | |
Protein Pathways | Lipoic acid metabolism, Metabolic pathways |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |