DNA Primase (PRIM2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PRIM2 antibody: synthetic peptide directed towards the middle region of human PRIM2. Synthetic peptide located within the following region: QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	primase (DNA) subunit 2
Database Link	NP_000938 Entrez Gene 5558 Human UniProt ID P49643
Background	The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.
Synonyms	p58; PRIM2A
Note	Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Dog: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 79%
Reference Data
Protein Pathways	DNA replication, Metabolic pathways, Purine metabolism, Pyrimidine metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.