DGLUCY Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C14orf159 antibody is: synthetic peptide directed towards the C-terminal region of Human C14orf159. Synthetic peptide located within the following region: AKKIPGISSTGVGDGGNELGMGKVKEAVRRHIRHGDVIACDVEADFAVIA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	chromosome 14 open reading frame 159
Database Link	NP_079228 Entrez Gene 80017 Human UniProt ID Q7Z3D6
Background	The function of this protein remains unknown.
Synonyms	C14orf160; DKFZp686I02128; FLJ20950; FLJ39943; FLJ39975
Note	Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.