Rbfox2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Rbfox2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Rbfox2. Synthetic peptide located within the following region: PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	RNA binding protein, fox-1 homolog (C. elegans) 2
Database Link	NP_001104297 Entrez Gene 93686 Mouse UniProt ID Q8BP71
Background	Rbm9 is a RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements.Rbm9 prevents binding of U2AF2 to the 3'-splice site. Rbm9 regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis. Rbm9 seems to act as a coregulatory factor of ER-alpha.
Synonyms	2810460A15Rik; AA407676; AI118529; Fbm2; Fxh; Hrnbp2; Rbm9
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 79%; Human: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.