B3GNT6 Rabbit Polyclonal Antibody
CAT#: TA329578
Rabbit polyclonal anti-B3GNT6 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-B3GNT6 antibody is: synthetic peptide directed towards the C-terminal region of Human B3GNT6. Synthetic peptide located within the following region: CSGGGFLLSGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYRELLLVHRFAP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 29 kDa |
Gene Name | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6 |
Database Link | |
Background | B3GNT6 is a beta-1,3-N-acetylglucosaminyltransferase that synthesizes the core 3 structure of the O-glycan, an important precursor in the biosynthesis of mucin-type glycoproteins. It plays an important role in the synthesis of mucin-type O-glycans in digestive organs. |
Synonyms | 3-Gn-T6; B3Gn-T6; beta-1; beta3Gn-T6; BGnT-6 |
Note | Immunogen sequence homology: Horse: 100%; Human: 100%; Rabbit: 93%; Rat: 92%; Dog: 86%; Pig: 86%; Bovine: 86%; Mouse: 83% |
Reference Data | |
Protein Pathways | Metabolic pathways, O-Glycan biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |