United States
Germany
Japan
United Kingdom
China
VAMP1 (NM_014231) Human Mass Spec Standard
CAT＃: PH320854
VAMP1 MS Standard C13 and N15-labeled recombinant protein (NP_055046)
View other "VAMP1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | VAMP1 MS Standard C13 and N15-labeled recombinant protein (NP_055046) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220854 |
| Predicted MW | 12.7 kDa |
| Protein Sequence |
>RC220854 representing NM_014231
Red=Cloning site Green=Tags(s) MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRAD ALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055046 |
| RefSeq Size | 2748 |
| RefSeq ORF | 354 |
| Synonyms | CMS25; SPAX1; SYB1; VAMP-1 |
| Locus ID | 6843 |
| Cytogenetics | 12p13.31 |
| Summary | Synapotobrevins, syntaxins, and the synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Mutations in this gene are associated with autosomal dominant spastic ataxia 1. Multiple alternative splice variants have been described, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2014] |
| Protein Families | Secreted Protein, Transmembrane |
| Protein Pathways | SNARE interactions in vesicular transport |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404313 | VAMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413817 | VAMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415422 | VAMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429412 | VAMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404313 | Transient overexpression lysate of vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 2 |
CNY 3,080.00 |
|
| LY413817 | Transient overexpression lysate of vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 3 |
CNY 3,080.00 |
|
| LY415422 | Transient overexpression lysate of vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1 |
CNY 3,080.00 |
|
| TP320854 | Recombinant protein of human vesicle-associated membrane protein 1 (synaptobrevin 1) (VAMP1), transcript variant 1, 20 µg |
CNY 2,900.00 |
