FABP4 (NM_001442) Human Mass Spec Standard
CAT#: PH302702
FABP4 MS Standard C13 and N15-labeled recombinant protein (NP_001433)
View other "FABP4" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FABP4 MS Standard C13 and N15-labeled recombinant protein (NP_001433) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202702 |
Predicted MW | 14.7 kDa |
Protein Sequence |
>RC202702 representing NM_001442
Red=Cloning site Green=Tags(s) MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQE FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001433 |
RefSeq Size | 619 |
RefSeq ORF | 396 |
Synonyms | A-FABP; AFABP; ALBP; aP2; HEL-S-104 |
Locus ID | 2167 |
Cytogenetics | 8q21.13 |
Summary | FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400558 | FABP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400558 | Transient overexpression lysate of fatty acid binding protein 4, adipocyte (FABP4) |
CNY 3,080.00 |
|
TP302702 | Recombinant protein of human fatty acid binding protein 4, adipocyte (FABP4), 20 µg |
CNY 2,900.00 |
|
TP720117 | Recombinant protein of human fatty acid binding protein 4, adipocyte (FABP4) |
CNY 4,550.00 |